DPCstruct | MC2144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 208 ± 49 aa |
| Standard deviation of domain lengths | 48.82 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6MH33 | 40-242 | PSKRMLEARNRFQVCEDINTQQLAEVLEKCLLKEPEEIVVLQASDPRALNTAVRAAAMIGQAGRLPLVLRFTGPPGGTSDSDDIWMS… |
| A0A7S2CG63 | 8-178 | EDTSKSVSFSIVGAALPDARQGFPVHLFSKNDANTNTAAKAVAIAYGKLEARGMYIGAEISFRDTRNELTFKIVQLEQPSDPSEHEI… |
| K8FCC9 | 33-227 | None |
| A0A7S0A4M2 | 6-202 | None |
| A0A1Q9E6A2 | 293-495 | None |
| A0A250XME3 | 214-420 | None |
| A0A812RH20 | 2-168 | None |
| A0A7J6R8L0 | 33-182 | None |
| A0A812V4R4 | 216-405 | None |
| A0A2J8AB66 | 6-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.