DPCstruct | MC21439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 7.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 45.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7W510 | 60-165 | KVSQMGLDLMTELARRMESHFKPYIPTVVPSVLDRLGDSKELVRDRCQLLLSTLMEVGAISPQQLWDRLSPAFSHKNSNVRDEIMKC… |
| A0A4W5JSW8 | 1-97 | FKCLSVALLGIDLLSALVTRLQDRFRNHVGTVLPSLIDRLGDSKDQVRDQDQILLLKIMEQAATPQYVWDRMLGGFKHKNNRTREGV… |
| A0A830I311 | 92-186 | None |
| A0A4Y2IYA5 | 2-83 | None |
| A0A2P8Y3A3 | 20-113 | None |
| A0A6P8GKN2 | 29-118 | None |
| A0A8B6CUE2 | 5-91 | None |
| A0A2J7QKY2 | 52-144 | None |
| A0A1S3I056 | 59-150 | None |
| A0A6J2PBW8 | 70-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.