DPCstruct | MC21438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 73 ± 13 aa |
| Standard deviation of domain lengths | 13.10 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 72.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091DNX1 | 93-166 | QEGVCEIWLTSEDTGAYGRDIGTSLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEEMAKILNHRRVYAFLHI |
| A0A4W5JNJ4 | 3-69 | EGVCEIWLTSEDTGAYGKDIGTDLPTLLWRLVEEIPEGAMLRLGMTNPPYILEHLEVLSLSVCSCVC |
| J4CDY7 | 620-708 | None |
| A0A4X3PQP0 | 242-315 | None |
| A0A498M958 | 14-88 | None |
| A0A6A2Y6E8 | 114-203 | None |
| A0A5A9N303 | 18-80 | None |
| A0A2W1BYK8 | 247-319 | None |
| A0A6J3CIW1 | 157-213 | None |
| V4TE28 | 113-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.