DPCstruct | MC21431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 163 ± 16 aa |
| Standard deviation of domain lengths | 16.13 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4VTQ0 | 3-165 | HPANAVFLNTVDLFSIVEEGKLGDPERLPAFVRRLRPDITDTRRLVLFELKPDNEESRREGREQAGRYLAALNDAVEPDKKLVGGTG… |
| A0A1Q3HWB1 | 8-166 | GNAAHRLIAYMYGVNHPQSEVHYNTKTLFDIVQRGKLGDPSRLLEGERELRPDIADVRRRHLFEIKPWNEQGLQDGRLEVRFYLDAL… |
| A0A1V5E8Q1 | 2-187 | None |
| A0A521QNQ3 | 35-220 | None |
| A0A0Q7BE10 | 328-517 | None |
| A0A3C1R8D7 | 381-553 | None |
| A0A372P0F3 | 36-195 | None |
| A0A398CUM0 | 284-442 | None |
| A0A0N1MVI6 | 89-231 | None |
| A0A0L0EUW0 | 126-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.