DPCstruct | MC2143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 4.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5LSG4 | 17-80 | LVSATEDPCAQMCSYVEGCAKSKFNSYCKTWQSPPVCFGLIKKSDGSICFEPTDADCVGEPIAC |
| A0A7J6M4N9 | 5-67 | VSATEDPCAQMCSYVEGCANSKYDSYCKSWQSPSVCFGLAKKADGSICFEPEDADCVGEPIAC |
| A0A7J6PE08 | 6-73 | None |
| C5LRU8 | 158-219 | None |
| C5L2B0 | 10-65 | None |
| A0A7J6LBD7 | 14-83 | None |
| A0A7J6KTX9 | 7-77 | None |
| A0A7J6PKY8 | 19-81 | None |
| A0A7J6TEN3 | 5-65 | None |
| A0A7J6LQ10 | 13-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.