DPCstruct | MC21427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 14.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G7TY05 | 6-101 | EGQESGEGCYDYLTELVRSSNFPFREVAKEKANLLIDEDDGETIRAKVFFDTQGTGTLGWVRYGVNDGSLLDITVDPEEPVVLRYDE… |
| C2M303 | 129-227 | ENPSEEVSDNLSCDELLTQIVQSSNITLIVKSSDCYVVQDRVEKDAIYAGVYTPTEGESKTMVLAWIKYNVREAKLYDITKDPDQPI… |
| A0A7G8YGH0 | 15-120 | None |
| A0A7I6WIM9 | 10-98 | None |
| A0A1H0YTW1 | 24-147 | None |
| A0A3D8IUN4 | 18-125 | None |
| A0A1M5FJE8 | 22-148 | None |
| J5V7I5 | 15-138 | None |
| A0A2T7BC13 | 17-136 | None |
| A0A848GJ34 | 41-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.