DPCstruct | MC21422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 312 ± 27 aa |
| Standard deviation of domain lengths | 26.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M9YJH4 | 71-383 | GFLLSTDLNEQSGFGICQHVDMKQKSGAVVPTNRHVIVVKFPRGHFTYTVQPSLPEVLACFPGSTASKLCQVSVQFTDNAQATIHGY… |
| A0A3M2SEZ3 | 7-320 | STTEEDGFGICHRLERRNAGLQVPTVTDTRTIRVKFPRGSITYSVDSLDDDKLQRLFPAATRLLSIVRVSLQPGSEVTVEGYGLPLA… |
| A0A0B4HJ12 | 16-380 | None |
| X0JN36 | 62-364 | None |
| A0A1J7J381 | 2-289 | None |
| Q2GNG4 | 1-268 | None |
| A0A2K0UU45 | 22-326 | None |
| T5ABT0 | 48-342 | None |
| A0A3L6NL96 | 42-351 | None |
| A0A428TEG3 | 1-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.