DPCstruct | MC2142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 219 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5K5F5 | 47-265 | ERPPNCLPPAVQFGNKDYCWFDLENKARTDRHAGLLVLSNGAYRNFFSTLELEVLWANSKPYDVGVWADGYTFRHIDLEYGLTLDLL… |
| A0A7J6KZM8 | 22-231 | GFKGAQASVQFSYPQGCNAKRKVDGKGFCVSGTSVSGKKLDATLTIFDAKDSSKSVGFLIEVAMKNYTPVGLKVTANGCATVMRKSY… |
| A0A7J6R3I5 | 16-248 | None |
| A0A7J6R8Z5 | 5-231 | None |
| A0A7J6MGX4 | 218-413 | None |
| A0A7J6NKR4 | 133-364 | None |
| C5LXI4 | 11-207 | None |
| A0A7J6MHL6 | 154-380 | None |
| A0A7J6LDZ3 | 27-252 | None |
| A0A7J6KPZ7 | 98-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.