DPCstruct | MC21414
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 247 ± 42 aa |
| Standard deviation of domain lengths | 41.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A667XWR1 | 41-291 | ESNHDACFFFFFFLTVYDGTGSCLKQMEVCLDDEICNRYLVPFVQACAAGQCNRTHCQQATRQFYSGMPYNVAEMLFMCECEAGAPN… |
| A0A821PHT0 | 11-201 | WVVLSTATLCEEARMRCAYRSGCGAALNNYMMLCSDVLAQPSDHCPKECEHALIALTSTEEGKELMNCQCEDEYCVDAKQKIYVCRA… |
| A0A7R9AAS9 | 103-411 | None |
| A0A3Q0J3D7 | 155-441 | None |
| A0A3S0ZDI2 | 35-227 | None |
| A0A2D0QM68 | 55-396 | None |
| A0A1Y1NLM4 | 38-249 | None |
| A0A1Y1NFT1 | 29-293 | None |
| E7FA79 | 50-315 | None |
| A0A6I8P881 | 112-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.