DPCstruct | MC21409
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Standard deviation of domain lengths | 9.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17196 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4ZYW1 | 2-62 | PSTEDAERALGRFFDARLRLVATPADESARRALEDAIYTLCVLMAEPSAHAAVVAAVQYTE |
| A0A0F4IME6 | 10-91 | PSPPAPGTLLPAPDVLRGHLNHLRALRRRTLAAPEDPGLRAALEDAAYTLCVLMGQRNAHGALLAAEERVAAHRLPPCAAPG |
| A0A387H4P0 | 1-70 | None |
| A0A7X1IJA7 | 1-79 | None |
| A0A7G7BUJ3 | 1-83 | None |
| A0A3N6FFA8 | 1-85 | None |
| A0A5P2UFM9 | 20-94 | None |
| B4VFI5 | 26-95 | None |
| A0A160NSG8 | 1-76 | None |
| A0A2K8PQX1 | 71-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.