DPCstruct | MC21402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 111 ± 10 aa |
| Standard deviation of domain lengths | 9.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.22 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | PF00086- PF18635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A384CS20 | 1-133 | MARGPGLALPSPPLPLLLLLLAATIGPAGAQDNCTCATNKMTLCRADGPGGRCQCRVLGLDFPVDCSTLTSKCLLLKARMRAPKSGR… |
| A0A4U1EFH1 | 1-117 | MAQGPGLALLPPSLLPPLLLLVAVIDQAAAQDNCTCPTSKMTVCDRSGPGGRCLCCVLGSGLDVDRSTLTSKCLLLKARVSARKSVR… |
| A0A6P3RK66 | 1-115 | None |
| A0A7J8E1V9 | 1-106 | None |
| A0A6P3IR35 | 74-185 | None |
| A0A6P3H059 | 162-271 | None |
| A0A2K5PXI9 | 14-110 | None |
| A0A673VZE7 | 2-104 | None |
| M7BWP6 | 469-575 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.