DPCstruct | MC21400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 46 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 59.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07911 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1C661 | 44-88 | EEVRQVECSCCGLKEECTAAYILEIQRRFAGKWVCGLCSEAVKER |
| A0A1D6KV03 | 1-45 | MEVESAKCECCGLREDCTREYIAAVKAGFGGRWLCGLCTEAVRDE |
| A0A7J7CKK0 | 5-48 | None |
| A0A833VK38 | 8-50 | None |
| A0A7I8J7K0 | 5-48 | None |
| A0A426YTP9 | 12-56 | None |
| A0A835RC41 | 62-107 | None |
| A0A2T7E1R6 | 212-257 | None |
| A0A6G1DPP5 | 1-46 | None |
| A0A835MXZ2 | 44-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.