DPCstruct | MC2140
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 178 ± 15 aa |
| Standard deviation of domain lengths | 15.22 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0F0B6 | 2-161 | FYTAVFDSQPDQADPAFPDTPRSTEFWTYAGQHSGLGPDLKSFDEPTRVGALHMGLIDNKKALLSSKVDGTPSAETPYPTTAQSNDF… |
| M1SV84 | 1-187 | MKLGTYERPKYWGVDGVIGDIYYYPDYTLFFRLKYNGSPSDKNWYYPKKEVNNQFWDWVGYYPGTMSEPKTWREPGIEGCIYYEPEY… |
| A0A3M4WV03 | 40-232 | None |
| A0A1T4W5S2 | 753-914 | None |
| E5B027 | 335-500 | None |
| A0A6P0LYW9 | 43-216 | None |
| A0A0P9NPV1 | 304-505 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.