DPCstruct | MC214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 249 ± 34 aa |
| Standard deviation of domain lengths | 33.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5BTE2 | 60-336 | LSEAKRKQFLTEYPRQQMFTKTDLAKYEVSFAGKPHIVSQGAQKNFISFASEIAKTWEKDDAYFSEQWFKDAVAKAIIFKEVDKMVM… |
| A0A849L6V2 | 14-248 | AAQKNFAAFAREIGEAWSKSDVGYDELWYRRLIAKAIIFRKLEAEVPKQPWYEGGYRANIVTYAMAKVFHDANSDNQVLDLDAIWRR… |
| A0A1W2CSY4 | 7-206 | None |
| A0A180F506 | 4-235 | None |
| A0A550DXZ5 | 67-302 | None |
| A0A845I1E2 | 603-882 | None |
| A0A8A3S5C5 | 379-667 | None |
| A0A1V3P9M9 | 1-197 | None |
| A0A6L4LJ73 | 368-615 | None |
| A3JQZ2 | 1-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.