DPCstruct | MC21399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 4.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 49.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02536 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A059BH24 | 137-191 | AELKRFPQYFSFSLERKIRPRHRMLEEHGLEMPLPEMLKISDGEFTSRLIEMRLR |
| A0A0A9FZ98 | 1-60 | MVQPLKDLIEFPRFFSYSLEDRIEPRYQTLVANRINIKLRYMLTGSDEEFAQRVREAVER |
| M7YNR5 | 1-67 | None |
| A0A7I8JIG9 | 179-240 | None |
| A0A6V7NP34 | 76-129 | None |
| A0A0A8ZDE6 | 1-60 | None |
| A0A540ML44 | 280-342 | None |
| A0A0V0HP42 | 1-56 | None |
| A0A453NY35 | 97-163 | None |
| A0A0D3F6U1 | 189-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.