DPCstruct | MC21396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 71 ± 6 aa |
| Standard deviation of domain lengths | 6.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L6QIQ2 | 82-145 | MTVEKQQAMRRFREQNMVYSYCYDTLRYPAALPECDVVESERRRFKDSGRLRFALRRRGPRRSS |
| J3L995 | 1-68 | MRRFRENNMVYSYCYDARRYPVPFPECDVVDSERRRFKNSGHLRLAFRRRRRPRPGSRPAKPTSAADM |
| A0A5P1F213 | 79-138 | None |
| A0A5N5HX38 | 701-779 | None |
| A0A0A9PH56 | 1-80 | None |
| A0A444CQN5 | 304-378 | None |
| A0A2G3DIS5 | 481-552 | None |
| A0A6V7QPL7 | 63-135 | None |
| A0A453IJ99 | 63-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.