DPCstruct | MC21392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 302 ± 36 aa |
| Standard deviation of domain lengths | 35.60 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A096PDC0 | 4-272 | RFPESIDFDPLIPSACIQLMTKQMQVHKAKLKGRRIVDLSCLETPAEPFLNDLTKRFEALSQQDSWANARDVKELAKKLFQKFDLSC… |
| A0A317VKS8 | 14-302 | LILAGYDEDINRLMASNPGLTSRFSETVTFKKPTPSQCWLLLRDSLGQVRQVDHAVIRQPDGQFHAWILTSFKHLSTLPGWGNGRDV… |
| A0A117NML6 | 432-789 | None |
| A0A0U5GCM3 | 8-268 | None |
| R1D9M5 | 487-830 | None |
| A0A175WBB2 | 1986-2277 | None |
| K5VP76 | 1-303 | None |
| A0A139AZ20 | 651-890 | None |
| A0A0D2LS38 | 22-327 | None |
| A0A7S4G5S7 | 12-317 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.