DPCstruct | MC21391
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 6.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7SXH4 | 1-97 | MNSALYSGWIGHRRFAPRRHEFRYKIGLLYLDLSEQDEVFALSPLAGRSRFAPFSFRETDYLKTFTQRGVRLIDAVRQQVAAAIGHA… |
| A0A432XAU5 | 1-99 | MTSRIYWGSVRHRRFIPKEHSFRYHLMQWGIALEELEQLNNTSKWFSTSERWAPLHFKPSDYLPGYYLPSHETLSTAVLRKMNSLSE… |
| A0A090P3S4 | 1-93 | None |
| A0A4Y9ZH24 | 36-145 | None |
| A0A6L7WQV7 | 81-173 | None |
| A0A2E0XIZ0 | 1-93 | None |
| A0A2N1T3B9 | 5-100 | None |
| A0A7S1NRL6 | 729-827 | None |
| B8PCC6 | 31-142 | None |
| A0A2W4KMF0 | 8-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.