DPCstruct | MC21388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 183 ± 19 aa |
| Standard deviation of domain lengths | 19.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A489FJB2 | 99-312 | KPVYEDTNIKIKLDKDTRNFIMPTITTNEIRNKLSYSFDGAGGTYSLLLSSYPISMNINLSKDDLWIFNIDNEVREISIENGTIKKG… |
| A0A7Z7PC07 | 3-181 | EKNRALIVPQLAREWHGKIEYKIKGNGGTYKLSLNSGIRIKLTDDTKNNQNSKWIIDASQLENSTVKIQNNQFTVGDIQIDVDVDSV… |
| A0A379G6C8 | 1-172 | None |
| A0A2R7RJH1 | 135-331 | None |
| A0A833N6K3 | 4-140 | None |
| A0A833JBT2 | 660-846 | None |
| A0A5E7UGR7 | 5-209 | None |
| D2U1Y8 | 281-454 | None |
| A0A6N6VXS2 | 595-769 | None |
| A0A4V0P2N1 | 249-418 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.