DPCstruct | MC21384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 59 ± 8 aa |
| Standard deviation of domain lengths | 8.21 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 60.93 |
| Pfam Score | 97.06 |
| Assigned Pfam label(s) | PF03040- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834CSA3 | 50-99 | TQEATVVPPYVALAIRRNPGFWEFVKVNSEDLSVDFITASEYLRFKEVIF |
| A0A287VFU7 | 1-54 | MIQEAIVISPWVALAIRPRPGVWEYVRVNVSELAVEELTVPEYLQFKEQLVEGR |
| A0A540L503 | 33-81 | None |
| A0A2I0K948 | 75-127 | None |
| A0A178UP79 | 72-148 | None |
| A0A426ZZH8 | 71-128 | None |
| A0A699ILH7 | 28-87 | None |
| A0A7J0FBF4 | 2-62 | None |
| A0A830CKD7 | 116-173 | None |
| G7JLQ3 | 48-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.