DPCstruct | MC21382
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 136 ± 20 aa |
| Standard deviation of domain lengths | 19.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287V925 | 26-171 | EGNDSSTRDEDIALVIPPVFDGCTKVLDADDQKAARDLYWEAVCSDDEATDRSKVEELLRQSVTKNPFVGEPRLVLAQMCLNAEMYE… |
| A0A7S1FWQ6 | 283-396 | VPLVFRRCTEVLSHADETAARDRYWDVTLHEKKMTADRQIELLRESVSLNPHVGEPHLLLSQLYFRQGDYLAAATEARESLEKLYVL… |
| A0A645FPZ8 | 3-105 | None |
| A0A7L5A5B6 | 151-323 | None |
| A0A261XTR4 | 502-625 | None |
| A0A2E3ER64 | 52-184 | None |
| A0A6A6MIX3 | 209-340 | None |
| A0A7N2KK48 | 192-354 | None |
| A0A5C7S2A1 | 168-280 | None |
| A0A7S1Z8Y0 | 132-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.