DPCstruct | MC21381
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 142 ± 13 aa |
| Standard deviation of domain lengths | 13.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04938 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2MEY5 | 1-135 | MEGDGVQNADLWNPACSDSIEGDGADTVLEEEYDEEVDSDDDYASIQRPAFAVKGEPDFDSGPPEDGLEFLRRVRWEAAHIPKVKVA… |
| A0A7N0V4C7 | 142-261 | HVPTNSRSQRQPSGLDEECSQDSDSDDEYDGILKPAFHVDGEPDFDSGPPEDGMEYLRRVRWEASQIPKVKVAKLDRGKINQSQSDY… |
| A0A383VW19 | 23-179 | None |
| A0A4S4D3X4 | 77-227 | None |
| A0A2N9ELG7 | 321-453 | None |
| A0A2I0AL70 | 100-248 | None |
| A0A176VGG0 | 186-336 | None |
| A0A816JRW5 | 309-431 | None |
| A0A6P6WVS6 | 435-590 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.