DPCstruct | MC2138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A3I9B1 | 1-59 | MTYVCLLCDAKEKIPYAVVREFDRMDEGDPSVPPMFSCEKCGAQMYPEYYKGIHGIEYR |
| A0A1I0CP32 | 1-81 | MSKKKKGNKKKSPQKVNLKNFIEYVCLGCKIVEKVPKEVVEYFDMMDDGDTSIPPRFSCESCGAEMYPKDYIGVHGEHYKI |
| A0A1S2MF29 | 1-63 | None |
| R7M5Y0 | 1-69 | None |
| A0A3Q9BIM5 | 31-95 | None |
| A0A430AY60 | 25-88 | None |
| A0A4R5L0R8 | 9-70 | None |
| A0A0H3J8Q2 | 29-89 | None |
| A0A6J4Z2M5 | 3-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.