DPCstruct | MC21376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 600 ± 107 aa |
| Standard deviation of domain lengths | 107.27 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287UNR9 | 104-595 | LRCLRHALRTTPSPDWWRRVLLVAPCYRSHSQTSTPGAVFSPDMIGEAVADRTIELLKLTNSETQCWQDWLLFADIFFFLMKSGCID… |
| K1QGD4 | 2-616 | AMERSENDDASNDECLSQLLWQHLSSQVIYFVLFQFASFPHMVVSLYEKLKGRNLNKGRDHLMWVLLQFISGSIQKNPLKEFLPVMK… |
| A0A7J7WW29 | 183-624 | None |
| Q55BN0 | 364-1131 | None |
| A0A817HLQ3 | 4-589 | None |
| A0A7R9AQT1 | 206-701 | None |
| Q10669 | 257-978 | None |
| A0A0C2JGI7 | 3-549 | None |
| A0A5B7DDN3 | 46-521 | None |
| A0A453PHV5 | 2-570 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.