DPCstruct | MC21375
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 121 ± 22 aa |
| Standard deviation of domain lengths | 21.75 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04352 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A098GGQ9 | 10-111 | KDKLQIIDWLVEHFPNAFFKKASQVRPLQIGIFDEIIDFYERLDTPPFSKKALREALSYYSSSPAYLNCQKANTARVDLFGNEVDIV… |
| A0A851G728 | 9-132 | APEQTSVKVTKVSLHQSFSRVCKQWPELWPEWKRRRFRPVIHGIADKMHKHVKANPGELLTHADIARVMRFVTGQLSYLEQITEGAD… |
| F2A9J5 | 32-185 | None |
| A0A318GLY6 | 1-137 | None |
| A0A2U8GH80 | 3-116 | None |
| A0A522ZUU3 | 13-125 | None |
| A0A1C2IG79 | 99-225 | None |
| A0A0F9U3Q1 | 8-115 | None |
| A0A2N9YFZ8 | 39-163 | None |
| A0A6N3R3I5 | 2-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.