DPCstruct | MC21371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 328 |
|---|---|
| Mean domain length (aa) | 143 ± 24 aa |
| Standard deviation of domain lengths | 24.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.74 |
| Pfam Score | 96.55 |
| Assigned Pfam label(s) | CL0688- PF18825 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8LJX0 | 14-132 | LVELFASRRPELEVGTLPFEVRKYLGCSRDTIFLSDQSARHIIQAHGDHITNTQLKLLPKILCEGLWLSDNRATHAVVSCNVYEVDY… |
| A0A1I2HDP9 | 61-209 | RSQPETGEAVARYARAVLSGQPVEPYRTMGLLTQAEAEAIAGMTGVEALRRELYDWTVGQYAPLHVRTEHGDEATESARGQRAVTAA… |
| A0A1V5XIV3 | 341-506 | None |
| A0A0K2XRE6 | 240-430 | None |
| A0A0K2YDI7 | 1-107 | None |
| A0A0K2Y4J4 | 5-140 | None |
| A0A0K2XY57 | 6-146 | None |
| A0A0K2XTF3 | 63-197 | None |
| T2SSK1 | 192-338 | None |
| R6I4M9 | 195-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.