DPCstruct | MC2137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 134 ± 19 aa |
| Standard deviation of domain lengths | 18.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6NZQ7 | 12-152 | PKRPLTRLEAHHFAAAAPNRWPYTREKHRLLSEFARTNEMQTTTRGFDLSTLAAPPGPRPRSSKAGVPPVSGFDHVQYFRRYRLPVA… |
| A0A351I4W7 | 24-144 | LMAVQGSDVVSRAYAEVVADEHREDFAKSRGLKQSDGRRCVQRLIGKQCNLHDCAPPAGDHDTLWVKDGKPALYLMQPYGLTWDDMK… |
| A0A5Q0M1T5 | 108-271 | None |
| A0A2K9IHI6 | 25-169 | None |
| A0A1C5J123 | 46-191 | None |
| A0A3D5DIT7 | 6-135 | None |
| A0A5C7Y225 | 12-149 | None |
| A0A2Z5JPH1 | 114-252 | None |
| A0A6I5MIT7 | 32-162 | None |
| A0A7Z0J7Q6 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.