DPCstruct | MC21369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 166 ± 39 aa |
| Standard deviation of domain lengths | 39.12 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A563E7X2 | 19-197 | MTADTDYPEIALLPATADGSPMRGVAGPDEGTLPLEDTSALIDVLRNHTRDVDRCWFCLWDGYGWDTAASYSSTAALLGDQTAPPVG… |
| A0A542F3Q3 | 73-209 | APDRRHPPCHRWFPHNSWPVAVQPPPEGSLDEESLDALLDALCRHSAAGPSTDCVAFYASLPANDFDNLHVWRGPLSAVPGLLEERG… |
| A0A6B0YHC0 | 113-262 | None |
| A0A3S5AJM1 | 100-288 | None |
| A0A6P1NEE2 | 71-255 | None |
| A0A7K1VLK4 | 29-199 | None |
| A0A2H1K1Q2 | 8-126 | None |
| A0A516X5M9 | 136-332 | None |
| A0A2A6FQC7 | 5-110 | None |
| A0A853DRA3 | 12-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.