DPCstruct | MC21368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 31.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2Z826 | 7-97 | TSARFNVSAVNSMSDEPLLISISNLPVKRKLTIHSSVTADNGALFECIAIYKSSEKGFIDLSEDPAIGGMYKGIEPMGLFWAMDPSK… |
| A0A563DZX3 | 62-144 | ATMRVSPAVAVADAPVSTMITGLPAGSRATVTSRATDDGGVRWKGSAAVRVPSDGVVSLGMPSTGGSYTGPNPMGLLDFMKPP |
| A0A2K5LED5 | 3-92 | None |
| A0A3Q1H5C9 | 5-95 | None |
| A0A7J5Y3F1 | 165-249 | None |
| G3HNG6 | 3-81 | None |
| A6TUZ5 | 6-96 | None |
| A0A5J5CEI6 | 2-89 | None |
| A0A511D2H4 | 78-175 | None |
| A0A3D2MNA4 | 12-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.