DPCstruct | MC21367
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 162 ± 21 aa |
| Standard deviation of domain lengths | 20.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4C9Q5 | 4-133 | AEKGLTCHQCKNLTDKVNLVFCSKCTKKRYCYDCIKKWYPETTSEEVQAACPFCMENCNCKACLRVKRPSDKDENVKLKQLQYLLLK… |
| G7LFD8 | 3-159 | ETDSLGAQDQDQPASEMHVDSIGCDVENDRCDQCKKVVQGKVVTCRHCKRERFCTRCLEDWYPHLKEADIATKCPVCCRNCNCTPCL… |
| A0A5B7BNT7 | 252-406 | None |
| A0A166AJB6 | 31-208 | None |
| A0A6J0PLG1 | 41-197 | None |
| A0A6P5FRH9 | 228-377 | None |
| A0A1U8FFD4 | 2-109 | None |
| A0A4U6TL64 | 1-125 | None |
| A0A835IPV8 | 14-161 | None |
| A0A835LAQ1 | 33-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.