DPCstruct | MC21366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 59 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D6N4W0 | 157-214 | VASGLGEWFEGREVRKWFMGRYYSGRVTDYDKDSRWYRVHYEDGDSEDLDWQELEEVL |
| A0A7S4A9G5 | 416-478 | KTLHPKYDVGTKFEKYFHSHGWFIGTVVAFGSESGFYSVRYEDKDTEELEEFELDKCKIQSVG |
| A0A396H9C7 | 1-69 | None |
| A0A1E7EXL3 | 20-69 | None |
| M1DAW1 | 53-117 | None |
| A0A5P1FF50 | 50-116 | None |
| K0S7C3 | 13-69 | None |
| A0A1Z5JX54 | 512-570 | None |
| A0A5D2PS28 | 2-55 | None |
| A0A314UBP8 | 2-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.