DPCstruct | MC21365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 315 ± 42 aa |
| Standard deviation of domain lengths | 42.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6MEZ8 | 1-285 | MFSLRGTEVMKNLLKQVIRKNISSKGRLTYGQIGRVVMVTLGLGKPDDDLCKEILDRFDGIDKNSPWKTFFQVLCVNSGETPGGLSL… |
| G7L077 | 44-385 | DVIEEIMAACTYNKKKHLSNEEVGRVMVELLGKKKIDDSVLEELRKMLNDRPSWVNFVNCMLGFDSVGTFAKELSMFWTLYKALQHS… |
| A0A1D6E0S0 | 369-717 | None |
| A0A438JRV3 | 325-672 | None |
| A0A2U1Q1Z7 | 1-278 | None |
| A0A1U8MZ82 | 166-528 | None |
| A0A396I7G0 | 82-408 | None |
| A0A2G3CK77 | 203-557 | None |
| A0A6J5VZF2 | 3-308 | None |
| A0A4Y7JJZ6 | 740-1045 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.