DPCstruct | MC21364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 138 ± 10 aa |
| Standard deviation of domain lengths | 9.61 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.51 |
| Pfam Score | 87.27 |
| Assigned Pfam label(s) | PF16712- PF16711 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7KL71 | 40-179 | DQIEEGAKLREVPSLEGHVLLKKQRDALEYLKGRFTGRNKEDVANSISMVEALAVKLTQKNEGELIQEKFKVKKLLNFLKQASEDAK… |
| A0A446VM25 | 55-191 | MKFEKGLSTATLLSNEVKCKQVALLERDILPKNLKSVLESLRGQVAGKYKDEIEESVSMVDILAVQLSKTENELLQQKTEVTRIATS… |
| A0A6D2HUV4 | 508-656 | None |
| A0A3B6KG25 | 18-146 | None |
| A0A484N039 | 69-215 | None |
| A0A2I0X1C1 | 159-300 | None |
| A0A1D6G9T5 | 80-214 | None |
| A0A396HGZ1 | 5-131 | None |
| A0A6J0NCB0 | 1-129 | None |
| A0A5N5HU03 | 81-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.