DPCstruct | MC21363
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 129 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N5CST6 | 88-213 | MYAFGLEECEQYDKAESYAKKALELNRHDAWATHALAHCMEMTGRTNEGIHFMESTESDWSKCFMLACHNYWHVALYHIELQKYDEA… |
| G7K8B1 | 1-151 | MLAFPLLELGQMKEAEEAAKRGFEINNQDGWSQHATCHVLQYECRFREAVEFMEECSPSWNSFLSFMLTHNWWHVALCYLEGNAPMQ… |
| A0A4W2HGH5 | 186-309 | None |
| A0A0D3D6Y5 | 153-278 | None |
| A0A0M3ITJ3 | 15-144 | None |
| A0A368FCR0 | 125-230 | None |
| A0A6S7H0S4 | 187-311 | None |
| A0A3P7IKC3 | 1-129 | None |
| A0A226E2F5 | 194-330 | None |
| A0A8B6FW60 | 10-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.