DPCstruct | MC2136
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 3.40 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4DV16 | 3-74 | IQIKLVSSENGFHDFDVQGAGFINRVTVSNDIQRGDMFNIYHGYSDENRRKSTGIWLGDKGIGGYLTGDLEK |
| A0A6G6ZX92 | 1-71 | MTNSTPIVTTLHASSNGFHDYDVIGHPLLRRVAIPHGIKDGEQFNVYYGEASKGGAAWRGGIEKSLEAWLS |
| A0A119VDF8 | 1-73 | None |
| A0A5C8YDA9 | 3-75 | None |
| D1K5B5 | 248-327 | None |
| A0A0C2NET4 | 118-184 | None |
| A0A6G9QPZ8 | 58-129 | None |
| A0A1N6X7R6 | 106-173 | None |
| A0A6I6LQJ7 | 177-241 | None |
| A0A2E8JQ02 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.