DPCstruct | MC21358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 58.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00925 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2XBZ2 | 1-68 | MLSMSNMKHDAIVGQGIPIHERVELPEELIPADSRVEIDAKITAGYFTTGKRMTTEELQAVQGRIWEE |
| A0A382AVF6 | 1-84 | MPDVLNWLGITRIDRFVSMSNMKYDALTMQGIDVGERVSIPDELIPEDAQVEMEAKKAAGYYSPDDVPSTTDLSRTRGRHLENY |
| D7FLZ3 | 290-357 | None |
| A0A3S4AMY0 | 171-252 | None |
| H0EIG8 | 213-289 | None |
| Q118D5 | 1-79 | None |
| A0A094A771 | 444-523 | None |
| A0A0A0HT52 | 152-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.