DPCstruct | MC21353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 62.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P4MAM9 | 62-135 | RVKNHEASNYLWELYYGGWAAPNIYFLGYAVVVKVGNIRIGGLSGIYNARHHERPPYNDNTIRSVYHVQEYDVH |
| A0A060S1N6 | 104-174 | SNYFWELYHGGWLAPNIYYLGHAGCVQVNGLRIAGASGIFKPADFHTGHHERPPYNHSALRSIYHIREYNV |
| A0A1U8MNN4 | 37-111 | None |
| A0A5D2WPY5 | 84-159 | None |
| A0A5A7QSU1 | 13-101 | None |
| U6LVQ5 | 4-67 | None |
| A0A0B0PVD2 | 1-81 | None |
| A0A7M7H0U0 | 88-158 | None |
| U6MJZ7 | 4-67 | None |
| A0A2K5YYR6 | 48-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.