DPCstruct | MC2135
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 132 ± 21 aa |
| Standard deviation of domain lengths | 21.18 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6Q4B0 | 165-274 | VYAACASNNLADAFGGAPITAIFPNGGASDTENTIEADSAYDCCVLAITTPNSAFFQYTPAAAGAAGSCGVYVLDASTTCAGQDTSL… |
| A0A7S8I1V6 | 1-124 | MTVETIIPAAEPVYAACGANNMMVTANGGRPVPYVDMTVGFGVASVGAAQGDAYKCCTACMQNPLCFLSFLADGDGSCTHINGNTNV… |
| A0A679P0G4 | 20-168 | None |
| A0A4Q2VLF4 | 34-178 | None |
| A0A316YDH8 | 237-355 | None |
| A0A6A6GHS0 | 539-679 | None |
| A0A5Q3GC21 | 575-730 | None |
| A0A6A6PTU1 | 149-255 | None |
| A0A6A6Q3N9 | 181-330 | None |
| A0A4U0WGC0 | 124-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.