DPCstruct | MC21349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 431 |
|---|---|
| Mean domain length (aa) | 267 ± 64 aa |
| Standard deviation of domain lengths | 63.82 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.85 |
| Pfam Score | 68.93 |
| Assigned Pfam label(s) | CL0123- PF00239- CL0167- PF14287 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7MFY8 | 4-218 | QVHLFSGGIIRCAHCGFAVTGERIRRNLLDGSVREHVYYRCANNSKPDEHPPMRWREGDLAEMFVEEFKTFVMPTEIAQWFRASIQT… |
| A0A135WFP8 | 51-314 | NFHPSTISSLLERRTYIGETNFKSSKFGEEITLKDTHEGIVTLEEYLQVREILANKQKFNTRTHAVTSPLDKLIYCKKCRRLMQVNL… |
| A0A1G5FYZ9 | 20-256 | None |
| A0A1C2Y043 | 123-470 | None |
| A0A347Q4I3 | 173-491 | None |
| A0A6G4V236 | 29-248 | None |
| A0A1Q6LGQ3 | 36-294 | None |
| A0A7W8XL15 | 4-250 | None |
| A0A0P6XLY3 | 165-381 | None |
| A0A6J4N1V8 | 279-694 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.