DPCstruct | MC21347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 644 |
|---|---|
| Mean domain length (aa) | 95 ± 21 aa |
| Standard deviation of domain lengths | 21.38 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.72 |
| Pfam Score | 99.57 |
| Assigned Pfam label(s) | CL0081- CL0029- CL0263- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U3LM11 | 118-183 | RKKNENTRSRYKGVWWEKDSQKWRAAIKMNNKRYHIGNYYHEREAALAYDKKARELFGEFARLNFP |
| A0A7S0ILC8 | 6-94 | SQGFARGSSGFRGVTQHPNGRWEARIGMPNSKHIYLGLYNEESAAARAYDMALVRLRGPGAATNYTLANYKDELKAFENDKPGGAQL… |
| A0A7S3JNR4 | 32-148 | None |
| A0A7S3N4K7 | 28-128 | None |
| A0A7S3N8K2 | 4-101 | None |
| A0A5J5UPQ7 | 30-100 | None |
| F6GVQ7 | 12-122 | None |
| A0A165Y472 | 11-122 | None |
| K8ENL8 | 68-185 | None |
| A0A6P5HF65 | 27-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.