DPCstruct | MC21345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 5.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.11 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0591- CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177AZ43 | 15-79 | DFHMQQMHEINWIVAAPSTPANMFHLIRRQMALPFRKPLIVMTPKSLLRHPDVRSSFKDIITGTE |
| A0A7J8E6T5 | 82-146 | TVNMVVVHPTTPAQYFHLLRRQMVRNFRKPLIVASPKMLLRFPAAVSSLQEMAPGTTFKPVIGDS |
| W7TU13 | 1-55 | None |
| A0A146KXX5 | 1-69 | None |
| A0A7R9MUG1 | 1-72 | None |
| A0A7R9AI99 | 124-187 | None |
| A0A812SXW1 | 81-147 | None |
| A0A397HF29 | 31-102 | None |
| A0A2A4IZD1 | 7-71 | None |
| A0A0F3Q9M6 | 1-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.