DPCstruct | MC2134
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 151 ± 27 aa |
| Standard deviation of domain lengths | 26.87 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 82.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01391 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A359E7J8 | 25-164 | DVEGDVDLVYSSTIVISENDFDPEDEFISVAEYGWDNLDEEMVDYGLVLGYIRFEGTTAWHALPYSVPFDDDLVNLRYLFDINNFSL… |
| A0A7X8BRT4 | 1-117 | VNIPVDANDWEWNNQALRWEVIYDLPELDEFIYEYGAQLAYVFIGKQGVNEVQKLLPYIETYDAGDDENGNPIYFTETISVDYQLGN… |
| A0A4D7JU81 | 12-178 | None |
| A0A086F7U4 | 6-140 | None |
| S7WMB4 | 44-202 | None |
| A0A173ME29 | 5-103 | None |
| D2QQM4 | 26-202 | None |
| A0A7C1LBV0 | 17-192 | None |
| A0A1G1NEC7 | 53-202 | None |
| A0A1H7JM19 | 49-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.