DPCstruct | MC21338
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 645 ± 71 aa |
| Standard deviation of domain lengths | 71.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 19.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0592 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2KIP0 | 309-772 | MGVANGQVSIDDTAANSIKTITVDGYATGSTIGDTNATEALETLSLKNAQTTATMTVADTAATLALTLEALGSSATVDAVLTFTNAP… |
| A0A6H9GKD4 | 181-889 | TVNLTPNVDTLTANSFLAPTVSSSGQFNATFNSGDNLTGSGTNPTLTVLNTGGDTINTGAVLPTMKGIETLNVVNTGKSTLEVLGAN… |
| R4V9H1 | 134-833 | None |
| A0A0S3PNT0 | 383-1014 | None |
| A0A554X207 | 2-614 | None |
| A0A0F5MP37 | 144-788 | None |
| A0A3M1FUR8 | 5-692 | None |
| A3V8Z9 | 2-684 | None |
| A0A7W6REI0 | 143-792 | None |
| A0A7G3GA46 | 3-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.