DPCstruct | MC21337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 14.31 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07102 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A411Z4K1 | 4-92 | AAGMPCSLRLPGICNHNPATTVMCHLPGIGKSIASKVSDLHTAFGCSACHTAIDTLGWDRRGLSAAVVLDAILRGHAETQARLVVMG… |
| A0A235ENW0 | 3-89 | RGMPCLLRVPGICTQDRATVVCCHSNLSIHGKAGARKADDQYSVWGCAACHRWLDQGPAPCAQKAAAFMAAHLAQVLEWRAIAFDGS |
| A0A369Z9S6 | 7-84 | None |
| A0A6L7G6C5 | 9-130 | None |
| A0A2S9REU2 | 87-178 | None |
| A0A4R9M7D0 | 100-210 | None |
| A0A826W2Y1 | 1-72 | None |
| A0A2X2BNS6 | 7-87 | None |
| A0A7W5IHL6 | 12-113 | None |
| T5LQF3 | 21-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.