DPCstruct | MC21335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 61 ± 2 aa |
| Standard deviation of domain lengths | 2.45 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 66.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J9UPM9 | 153-215 | ASCGKCIKVTNRATGASIVARIVDQCSNGGLDLDYETVFKKIDTNGQGFQKGHLNVNYQFVSC |
| M1BPP7 | 63-124 | ASCGRCLRVTNTGTGTQETVRIVDQCSNGGLDLDVNVFNRLDTNGLGYQRGNLNVNYEFVNC |
| A0A1E5UW66 | 8-65 | None |
| A0A4S4DYW5 | 241-298 | None |
| A0A2N9G5M3 | 374-437 | None |
| A0A287V7Q7 | 190-248 | None |
| A0A0E0F773 | 338-400 | None |
| A0A251NZX9 | 111-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.