DPCstruct | MC21334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 68 ± 17 aa |
| Standard deviation of domain lengths | 16.90 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 81.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 61.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7ZYG0 | 1-60 | MAAGAALVVRSAHGARGFLCPVVEPAEVRRGGFQVLAVHHPENAEMVYSVIVARKGYLEL |
| A0A151R2F8 | 98-151 | MAPGAFLVLRSAHGARAFLYPVVDPCSDLKGFEVLSVFHPTDEVINSVIVARKH |
| A0A151SW39 | 95-148 | None |
| A0A699IYQ0 | 45-98 | None |
| A0A392PAF4 | 45-101 | None |
| A0A172Q4H2 | 209-299 | None |
| Q10MI8 | 379-491 | None |
| A0A7I8IAB9 | 1-65 | None |
| A0A2U1LP22 | 1-80 | None |
| A0A4P1QVT2 | 68-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.