DPCstruct | MC21333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 18 aa |
| Standard deviation of domain lengths | 18.29 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 65.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 40.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0YH76 | 1-77 | MSDEGGCEDQYGHIYFLGFHPYKEVIFLGLSFIGVAYHLNSSKVQYLGKLHPKDYCTTYSNGIYESFMYTPCMVGEL |
| M7ZHA0 | 55-156 | LNSGKEQLVEEKFEWDSENDNILHKEDVVDARGNGYFDILGFHPYKEIVFLGVSMYRGIAYHLKDSKVQDLGYLYPTTCHLALQNEC… |
| A0A3L6R4F8 | 1-134 | None |
| A0A5J9T5P6 | 176-266 | None |
| A0A0E0Q7P5 | 1-114 | None |
| A0A0E0NYZ9 | 246-368 | None |
| B9FA70 | 317-405 | None |
| M8C5Q6 | 83-209 | None |
| N1QYC3 | 454-575 | None |
| K3ZMT9 | 6-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.