DPCstruct | MC21332
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 60 ± 3 aa |
| Standard deviation of domain lengths | 3.36 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 60.81 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0758- PF01778 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D2I5Y7 | 2-61 | QNDEVTWGILNKYCSYKAEIETGKFCRNPDNVTGSCNRISCPLANSRYATIKDHDGVFYL |
| M7ZFS0 | 3-57 | DEVIWHCLRHNHCSFMAKIETGLFCRNPYNATGICNRSSCPFANSRYATIRDHDG |
| A0A0F7SUA4 | 4-62 | None |
| A0A2B4S590 | 4-58 | None |
| A0A6V7WWR2 | 95-159 | None |
| A0A4S8IY64 | 4-62 | None |
| A0A505HUT5 | 1-67 | None |
| A0A7R9TYG8 | 4-62 | None |
| A0A834VRL9 | 4-63 | None |
| A0A2H3HHF9 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.