DPCstruct | MC21329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 7 aa |
| Standard deviation of domain lengths | 6.51 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6XZ56 | 1-124 | MLAQSLPPEQPVNVIVRNRNTLADVRAASGEEERYSHSDLNGFAANAQTARKVVDLLRPMLSKSDADLLPKIDKALADFDSELDSYK… |
| A0A378MFV3 | 1-108 | MELLNEAATTKITGEEEAYSHTDLVDLNANVEGSKVVYQAIVPALTAQDKKLADDIDAAFNKMEDTLAAYREGDSFVNYKKLSKKQI… |
| A0A6B1MK65 | 71-189 | None |
| A0A4U0Q6Z4 | 505-627 | None |
| A0A2Z5QYQ8 | 1-127 | None |
| D4DM20 | 97-212 | None |
| A0A378F898 | 253-378 | None |
| A0A5B1LDT4 | 210-327 | None |
| A0A7J5CIX2 | 67-173 | None |
| A0A1M3ANE0 | 246-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.