DPCstruct | MC21328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 275 ± 37 aa |
| Standard deviation of domain lengths | 36.63 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A085VZK4 | 1-252 | MPAADIQSAATSIFTQLEAAEFSTQRYALLFKPGTYNVTFNVGFYTHVAGLGQHPDNVTINGGVNVNADWDNGNATRNFWRAIENLS… |
| A0A378MF73 | 2-244 | VIFSPQDDQARINKKMDAIYKKQKDAQFGPDRFGVYFLPGDYTKGQPNHVYNIGYYTSINGLGAVPTQTKLANVASPAALPDNNGTC… |
| A0A812RA58 | 2-279 | None |
| A0A7W8J1S2 | 1-208 | None |
| A0A4R8WS51 | 52-377 | None |
| A0A7S1ZMJ0 | 2-230 | None |
| A0A175XZS0 | 270-549 | None |
| Q1ZN36 | 262-563 | None |
| A0A812PRX4 | 32-295 | None |
| A0A286I731 | 28-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.